PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI08G14710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 359aa    MW: 36776.2 Da    PI: 6.717
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI08G14710.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding591.1e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l++++++ G g+W+t +r  g++R++k+c++rw +yl
  OMERI08G14710.1 14 KGPWTPEEDEKLLHYIQKNGHGSWRTLPRLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding55.11.8e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ +++++  lG++ W++Ia +++ gRt++++k++w+++l
  OMERI08G14710.1  67 RGKFSQEEEQTILHLHSILGNK-WSAIATHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-25564IPR009057Homeodomain-like
PROSITE profilePS5129418.45961IPR017930Myb domain
SuperFamilySSF466891.35E-3111108IPR009057Homeodomain-like
SMARTSM007178.7E-151363IPR001005SANT/Myb domain
PfamPF002491.2E-161461IPR001005SANT/Myb domain
CDDcd001671.31E-111661No hitNo description
PROSITE profilePS5129426.79662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2765117IPR009057Homeodomain-like
SMARTSM007179.2E-1766114IPR001005SANT/Myb domain
PfamPF002492.5E-1667112IPR001005SANT/Myb domain
CDDcd001671.54E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MGRSPCCDES GLKKGPWTPE EDEKLLHYIQ KNGHGSWRTL PRLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQEEEQTILH LHSILGNKWS AIATHLPGRT DNEIKNFWNT HLKKRLIQMG  120
FDPMTHRPRT DFFAALPQLI ALATLRGQLA ATACGGGGGG DPAAAAAQIM QGAGGGGGGG  180
GGGADVAIQA AKMQYLQCLL QSAASTIASA GSGGGAAMSA HDADAALAAA AAAATCSSSP  240
AGSSVPITPT AVGHSVGGQT QTTPCAFSEA PVITSDDVEA NLRLLGCGGG GADAFACHGG  300
SLPPLADLSD VTTTTMTNPL DWCSATASSS CGGGGGGGAS SPFPWPEFFH DDPFITDFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31121165108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0043760.0AP004376.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0481F05.
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973754.11e-135PREDICTED: myb-related protein Hv33-like
TrEMBLA0A0E0EMJ40.0A0A0E0EMJ4_9ORYZ; Uncharacterized protein
STRINGLOC_Os08g37970.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112637132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.12e-93myb domain protein 93